Scaffold Ga0055584_100245999

Overview

Basic Information

• Taxon OID: 3300004097
• Scaffold ID: Ga0055584_100245999
• Source Dataset Name: Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1824
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location

• Location Name: Helgoland, North Sea, Atlantic Ocean
• Coordinates
  • Lat. (^o): 54.18194
  • Long. (^o): 7.9

Associated Families

Family	Category	Number of Sequences	3D Structure?
F044465	Metagenome / Metatranscriptome	154	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0055584_1002459993	F044465	GGAG	MKNMDRVEQEMKGPSYMEQTMVMETLRSTDMSLVPESFHGKSWDDEELLEGFQLAQAQIHSKNYRLASSILVFCHRLLKERCE*