Scaffold Ga0065178_101013

Overview

Basic Information

• Taxon OID: 3300004093
• Scaffold ID: Ga0065178_101013
• Source Dataset Name: Cyanobacterial communities from the Joint Genome Institute, California, USA - FECB-22 (version 2)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 14490
• Total Scaffold Genes: 18
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 12 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Microbial → Bacteria → Unclassified → Unclassified → Cyanobacterial → Cyanobacterial Communities From The Joint Genome Institute, California, Usa

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 37.9313884
  • Long. (^o): -122.0239394

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053413	Metagenome / Metatranscriptome	141	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0065178_10101314	F053413	AGAAG	MFLSPLRERLGEGVNADVSSCITPSPSLSPKGERSMNSLR*