Basic Information | |
---|---|
Taxon OID | 3300003976 Open in IMG/M |
Scaffold ID | Ga0064219_11863 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Barrow, Alaska NGEE-2011 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Yale School of Medicine |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1169 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Ngee-Artic Barrow Site, Alaska, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Barrow, Alaska | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F071789 | Metagenome | 122 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0064219_118632 | F071789 | N/A | MRRLLCVALFLATSIGIIVLPAAADTSSGKVLLSFDYSDNSAPASVSNGSFNVIVDVLPGDSTGLVRMFAVAPASTNASSIVCHFQWINQSQAECAFNFPDNGVWAIHAQYVLGPQTDVVGVAVTNLRVLN* |
⦗Top⦘ |