Basic Information | |
---|---|
Taxon OID | 3300003951 Open in IMG/M |
Scaffold ID | Ga0064030_11559 Open in IMG/M |
Source Dataset Name | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS907_80_12L10 |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Marine Biological Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 592 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Anemone diffuse flow vent, Axial seamount | |||||||
Coordinates | Lat. (o) | 45.933 | Long. (o) | -130.014 | Alt. (m) | Depth (m) | 1542 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F019998 | Metagenome / Metatranscriptome | 226 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0064030_115591 | F019998 | N/A | TSGVPSAYACLETDYRQNSLSVAATAGASSITLTDAVEYIAGDYIGIASDSNGLMWYKVNTVVGQVVNLYEVGTTTAASLDYAASVDAIVVGFTTLVWQPLRIIEARRVDLSSGIEVPSMIVGKFDYERIPNKAMTSIPLWLYAQTKIAETQVFVWPPTAYANWAIGYSFERRYQDVDSGINSMDFPPEAYESLRYG |
⦗Top⦘ |