NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0064030_11559

Scaffold Ga0064030_11559


Overview

Basic Information
Taxon OID3300003951 Open in IMG/M
Scaffold IDGa0064030_11559 Open in IMG/M
Source Dataset NameDiffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS907_80_12L10
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterMarine Biological Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)592
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Source Dataset Sampling Location
Location NameAnemone diffuse flow vent, Axial seamount
CoordinatesLat. (o)45.933Long. (o)-130.014Alt. (m)Depth (m)1542
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019998Metagenome / Metatranscriptome226N

Sequences

Protein IDFamilyRBSSequence
Ga0064030_115591F019998N/ATSGVPSAYACLETDYRQNSLSVAATAGASSITLTDAVEYIAGDYIGIASDSNGLMWYKVNTVVGQVVNLYEVGTTTAASLDYAASVDAIVVGFTTLVWQPLRIIEARRVDLSSGIEVPSMIVGKFDYERIPNKAMTSIPLWLYAQTKIAETQVFVWPPTAYANWAIGYSFERRYQDVDSGINSMDFPPEAYESLRYG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.