Scaffold Ga0063230_11868124

Overview

Basic Information

• Taxon OID: 3300003938
• Scaffold ID: Ga0063230_11868124
• Source Dataset Name: Wetland microbial communities from Twitchell Island in the Sacramento Delta, California, USA - surface sediment Aug2011 Site C1 Bulk Metatranscriptome (Metagenome Metatranscriptome) (version 2)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 612
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland → Microbial Community Impact On Carbon Sequestration In Managed Wetland Carbon Farming

Source Dataset Sampling Location

• Location Name: California, United States
• Coordinates
  • Lat. (^o): 38.1075
  • Long. (^o): -121.6497
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011719	Metagenome / Metatranscriptome	288	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0063230_118681241	F011719	N/A	PSCKTRRGGSIHQFLWRRSRAAGKREVGTER*GAIRSRSESSQVVPAGFGPERIAVTPRVNGCYCASARTSGSGGSRKGVSQMKDAERRDKLSVRTGKDTRSGQDP*KPFETSAILQTIPLAYERKAT*E*RGETRGTGQTRCQKQRPTRR*