NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0063230_11613389

Scaffold Ga0063230_11613389


Overview

Basic Information
Taxon OID3300003938 Open in IMG/M
Scaffold IDGa0063230_11613389 Open in IMG/M
Source Dataset NameWetland microbial communities from Twitchell Island in the Sacramento Delta, California, USA - surface sediment Aug2011 Site C1 Bulk Metatranscriptome (Metagenome Metatranscriptome) (version 2)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)818
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland → Microbial Community Impact On Carbon Sequestration In Managed Wetland Carbon Farming

Source Dataset Sampling Location
Location NameCalifornia, United States
CoordinatesLat. (o)38.1075Long. (o)-121.6497Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F069733Metatranscriptome123N

Sequences

Protein IDFamilyRBSSequence
Ga0063230_116133891F069733N/AMAGRSSFCNCSFPSGLYIPSLHRSSSQSCNWFENRRFLSCSCEQFGKPDLKGVGFLQILTQAFLRLLEFSTRFTLYLLINRLISFPCGFVIKQKIAECRSFVRRIKISLRISLSRAAFANLYELASIYLGHPCEQPAQSKLFTKISLNYSTSTYLSYPCEQLARLRLFTSTCLAAKIHSLLRGLASAWVFVPCETLKPFCLKRTFSTSWDRTVSDIAIVDLSCTGIPINTS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.