Basic Information | |
---|---|
Taxon OID | 3300003938 Open in IMG/M |
Scaffold ID | Ga0063230_11613389 Open in IMG/M |
Source Dataset Name | Wetland microbial communities from Twitchell Island in the Sacramento Delta, California, USA - surface sediment Aug2011 Site C1 Bulk Metatranscriptome (Metagenome Metatranscriptome) (version 2) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 818 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland → Microbial Community Impact On Carbon Sequestration In Managed Wetland Carbon Farming |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | California, United States | |||||||
Coordinates | Lat. (o) | 38.1075 | Long. (o) | -121.6497 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F069733 | Metatranscriptome | 123 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0063230_116133891 | F069733 | N/A | MAGRSSFCNCSFPSGLYIPSLHRSSSQSCNWFENRRFLSCSCEQFGKPDLKGVGFLQILTQAFLRLLEFSTRFTLYLLINRLISFPCGFVIKQKIAECRSFVRRIKISLRISLSRAAFANLYELASIYLGHPCEQPAQSKLFTKISLNYSTSTYLSYPCEQLARLRLFTSTCLAAKIHSLLRGLASAWVFVPCETLKPFCLKRTFSTSWDRTVSDIAIVDLSCTGIPINTS* |
⦗Top⦘ |