Scaffold Ga0063012_10001815

Overview

Basic Information

• Taxon OID: 3300003892
• Scaffold ID: Ga0063012_10001815
• Source Dataset Name: Hot spring sediment microbial communities from Chocolate Pots, Yellowstone National Park, Wyoming that are Fe(III) reducing - CP Core 2, 1cm
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Wisconsin, Madison
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 82468
• Total Scaffold Genes: 100
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 68 (68.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Sediment → Hot Spring Sediment Microbial Communities From Chocolate Pots, Yellowstone National Park, Wyoming That Are Fe(Iii) Reducing

Source Dataset Sampling Location

• Location Name: Chocolate Pots Hot Spring, Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.427936
  • Long. (^o): -110.588466
  • Depth (m): .01

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007851	Metagenome / Metatranscriptome	343	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0063012_1000181520	F007851	N/A	MLPEFIRTLIVILLGVCFAYLYGFIEHGYIPPAEHLRLRFFHHFALYHIVMFGLFSALPLVVLVFDTSWQGVMLAFGLWAFLPLGEDIAWYRFAGTWPTAEDWTSWGGGFTVLGKWLPKWYAVNASLSVVFFGLAMTLAFS*