Scaffold Ga0063162_1196808

Overview

Basic Information

• Taxon OID: 3300003890
• Scaffold ID: Ga0063162_1196808
• Source Dataset Name: Hot spring sediment microbial communities from Chocolate Pots, Yellowstone National Park, Wyoming that are Fe(III) reducing - Chocolate Pots Core 3, 1cm
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Wisconsin, Madison
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 825
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Sediments → Hot Spring Sediment Microbial Communities From Chocolate Pots, Yellowstone National Park, Wyoming That Are Fe(Iii) Reducing - Cp Core 3 , 1Cm

Source Dataset Sampling Location

• Location Name: Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.427936
  • Long. (^o): -110.588466

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067507	Metagenome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0063162_11968082	F067507	N/A	PSRAGIAVIKSFLDKNEPAVRRLSIDDQIDDQFVRELEESGFFANLQRGK*