Scaffold Ga0062441_1070526

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0062441_1070526

Scaffold Ga0062441_1070526

Overview

Basic Information
Taxon OID	3300003889 Open in IMG/M
Scaffold ID	Ga0062441_1070526 Open in IMG/M
Source Dataset Name	Freshwater pond sediment microbial communities from Middleton WI, enriched with Humin and Glucose under anaerobic conditions - HM Sample 1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Wisconsin
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	525
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Anaerobic Enrichment Culture → Freshwater Pond Sediment Microbial Communities From Middleton Wi, Enriched By Humin And/Or Glucose Under Anaerobic Conditions

Source Dataset Sampling Location
Location Name	Middleton, WI
Coordinates	Lat. (^o)	43.0603	Long. (^o)	-89.5717	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001819	Metagenome / Metatranscriptome	630	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0062441_10705262	F001819	N/A	TEVFQTLTNDCHLKHPAVHQSTALVVLTMVRLLAYTLSLVFYHRQIRSHVHGRCPGFHEFAKRMTYWFVALSADTS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.