Scaffold Ga0062441_1024357

Overview

Basic Information

• Taxon OID: 3300003889
• Scaffold ID: Ga0062441_1024357
• Source Dataset Name: Freshwater pond sediment microbial communities from Middleton WI, enriched with Humin and Glucose under anaerobic conditions - HM Sample 1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Wisconsin
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1460
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium GWF2_41_31 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Anaerobic Enrichment Culture → Freshwater Pond Sediment Microbial Communities From Middleton Wi, Enriched By Humin And/Or Glucose Under Anaerobic Conditions

Source Dataset Sampling Location

• Location Name: Middleton, WI
• Coordinates
  • Lat. (^o): 43.0603
  • Long. (^o): -89.5717

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017253	Metagenome	242	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0062441_10243571	F017253	N/A	LVIVVIYKIACNVGSYTQGRTAGDFLSNRKAARAEKCPPKTFAAELAG*