Scaffold Ga0062443_1075623

Overview

Basic Information

• Taxon OID: 3300003887
• Scaffold ID: Ga0062443_1075623
• Source Dataset Name: Freshwater pond sediment microbial communities from Middleton WI, HM 5/6 enriched by Humin under anaerobic conditions -HM Sample 3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Wisconsin, Madison
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1571
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → unclassified Candidatus Competibacteraceae → Candidatus Competibacteraceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Anaerobic Enrichment Culture → Freshwater Pond Sediment Microbial Communities From Middleton Wi, Enriched By Humin And/Or Glucose Under Anaerobic Conditions

Source Dataset Sampling Location

• Location Name: Middleton, WI
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085790	Metagenome / Metatranscriptome	111	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0062443_10756233	F085790	N/A	PCVNPCSPNLSLKSDPACIAFRSLSAFSYLGSARHLGAGVAA*