Basic Information | |
---|---|
Taxon OID | 3300003878 Open in IMG/M |
Scaffold ID | Ga0063282_1025030 Open in IMG/M |
Source Dataset Name | Plastic marine debris microbial communities from the Atlantic Ocean - SEA_0142_20120611_metagen |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Marine Biological Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3741 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Plastic Marine Debris Microbial Communities From The Atlantic Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Atlantic Ocean | |||||||
Coordinates | Lat. (o) | 39.978 | Long. (o) | -68.882 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F028441 | Metagenome / Metatranscriptome | 191 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0063282_10250303 | F028441 | N/A | MSLKQLIKLEDKAKEVWVISPTLHYDTENKDFSELVSVNLGEKTKYRYIVPATKTVEKNIKLYKKMYKVSEADIANNFLILPDSEFIPFMEETAIYNASGKCVACAAPATEDSNDVIKFNPETSKTMAKAFKSVWKKYKRTNP* |
⦗Top⦘ |