Scaffold Ga0007879_1002634

Overview

Basic Information

• Taxon OID: 3300003813
• Scaffold ID: Ga0007879_1002634
• Source Dataset Name: Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2901
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: Crystal Bog, Wisconsin, USA
• Coordinates
  • Lat. (^o): 46.0072
  • Long. (^o): -89.6063

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071905	Metagenome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0007879_10026342	F071905	AGGAGG	MAKGFTPWENRDWVYKRYVVEKKTVLQMAMEARCSHMTIQRALXKFDLXKKPRKWSK*