Scaffold Ga0049116_10038618

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0049116_10038618

Scaffold Ga0049116_10038618

Overview

Basic Information
Taxon OID	3300003786 Open in IMG/M
Scaffold ID	Ga0049116_10038618 Open in IMG/M
Source Dataset Name	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius vacuus BELIZE.2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	941
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations

Source Dataset Sampling Location
Location Name	Germany: Marburg
Coordinates	Lat. (^o)	50.8	Long. (^o)	8.81	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001452	Metagenome	691	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0049116_100386182	F001452	N/A	GKDCDPMGFGIWELLDGKIWEWDLSFRWDWDGNGNEVIQIGGICYEKSIPAHLYFA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.