Scaffold Ga0055542_1041530

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0055542_1041530

Scaffold Ga0055542_1041530

Overview

Basic Information
Taxon OID	3300003762 Open in IMG/M
Scaffold ID	Ga0055542_1041530 Open in IMG/M
Source Dataset Name	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	540
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Source Dataset Sampling Location
Location Name	USA: North Carolina
Coordinates	Lat. (^o)	35.6667	Long. (^o)	-78.5097	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053329	Metagenome / Metatranscriptome	141	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0055542_10415301	F053329	N/A	CSSRWAAAGSPTRKPRPDGIRFALDERAVDGVPQDSAMPPDLENPSAHEPALSRNHAAGVPRETASPAERALAPDGDAPMQSASATADDGTYVGQAGGYMGGPLPAVESGHAEVDKANVRGDGAYGFPAGPGVGVPGGEHQPAAQKPDVVPNPYPER*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.