Basic Information | |
---|---|
Taxon OID | 3300003762 Open in IMG/M |
Scaffold ID | Ga0055542_1011511 Open in IMG/M |
Source Dataset Name | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1566 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: North Carolina | |||||||
Coordinates | Lat. (o) | 35.6667 | Long. (o) | -78.5097 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F080973 | Metagenome | 114 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0055542_10115111 | F080973 | N/A | IARAICQLTGIPTCEIDLGPSRVLIHPDTRCGYNWSYPDAMVKARFRPFVHRAVSMVRDQYPILR* |
⦗Top⦘ |