Scaffold Ga0055539_1000407

Overview

Basic Information

• Taxon OID: 3300003752
• Scaffold ID: Ga0055539_1000407
• Source Dataset Name: Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 16497
• Total Scaffold Genes: 18
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 10 (55.56%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Source Dataset Sampling Location

• Location Name: USA: North Carolina
• Coordinates
  • Lat. (^o): 35.6667
  • Long. (^o): -78.5097

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060114	Metagenome / Metatranscriptome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0055539_10004078	F060114	N/A	MTSPLTELFEQQRIENARLSGQIVALEMAVKLLFMQHPQPNALAGFYSKAIDGLLDITLATRMPEEMRDALDQARNGLLEALRQQPTLGGG*