Basic Information | |
---|---|
Taxon OID | 3300003752 Open in IMG/M |
Scaffold ID | Ga0055539_1000284 Open in IMG/M |
Source Dataset Name | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 28851 |
Total Scaffold Genes | 26 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 19 (73.08%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: North Carolina | |||||||
Coordinates | Lat. (o) | 35.6667 | Long. (o) | -78.5097 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F023378 | Metagenome / Metatranscriptome | 210 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0055539_10002845 | F023378 | AGGA | MSKTYVVSGCGMKFDAALWPVPAGVEIHFYFQCMREPQLYKTRTILDKLMLDVGMFPDRVAMPGDMIPSHFVWAHAGEQPPSGVFRRQTGNLAMDLADTDASRPVALSHIVKTLSADRSRSNTAIHWIVRDSEELADPSGLDCQYPPRLRAGGSDDGDESREMPLSGQMPLGQSRRMPLGMGPTEAWPGVRRR* |
⦗Top⦘ |