Scaffold LSCM3L_1020349

Overview

Basic Information

• Taxon OID: 3300003667
• Scaffold ID: LSCM3L_1020349
• Source Dataset Name: Lithgow State Coal Mine Metagenomic Study (LSCM 3 Late (Sample 2))
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1186
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanospirillaceae → Methanospirillum → Methanospirillum stamsii (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water → Coalbed Water Microbial Communities From The Lithgow State Coal Mine, New South Wales, Australia

Source Dataset Sampling Location

• Location Name: Lithgow State Coal Mine, New South Wales, Australia
• Coordinates
  • Lat. (^o): -33.460524
  • Long. (^o): 150.168149

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047561	Metagenome	149	Y

Sequences

Protein ID	Family	RBS	Sequence
LSCM3L_10203491	F047561	N/A	MVKSNIQPQNIVPDFGTLRHGKLDILVNWNITSATKTDDMGNEYTEWSYESVRLNWILPAVYESEAAVQAYLNANYDAGENILGWAQATRVNKSSVGT*