Scaffold LSCMMerge_1009643

Overview

Basic Information

• Taxon OID: 3300003660
• Scaffold ID: LSCMMerge_1009643
• Source Dataset Name: Coalbed water microbial communities from the Lithgow State Coal Mine, New South Wales, Australia (LSCM Merged)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2393
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water → Coalbed Water Microbial Communities From The Lithgow State Coal Mine, New South Wales, Australia

Source Dataset Sampling Location

• Location Name: Lithgow
• Coordinates
  • Lat. (^o): -33.460524
  • Long. (^o): 150.168149

Associated Families

Family	Category	Number of Sequences	3D Structure?
F101222	Metagenome / Metatranscriptome	102	N

Sequences

Protein ID	Family	RBS	Sequence
LSCMMerge_10096433	F101222	AGGA	MNVWVAIAINIVVYLVSFAYAWGKLNTKISDIEKRYYELEGKMSDIMECSIQKEQYKSEQQNINRRIDEITSLNIDARLTKIETLLVTILGELKDGKYTK*