Basic Information | |
---|---|
Taxon OID | 3300003660 Open in IMG/M |
Scaffold ID | LSCMMerge_1000013 Open in IMG/M |
Source Dataset Name | Coalbed water microbial communities from the Lithgow State Coal Mine, New South Wales, Australia (LSCM Merged) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 317015 |
Total Scaffold Genes | 309 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 255 (82.52%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water → Coalbed Water Microbial Communities From The Lithgow State Coal Mine, New South Wales, Australia |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lithgow | |||||||
Coordinates | Lat. (o) | -33.460524 | Long. (o) | 150.168149 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F017885 | Metagenome / Metatranscriptome | 238 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
LSCMMerge_100001332 | F017885 | GGAG | MVDVEACRIAFQCPQCGRELEQTIGKLKSQARMICPGCSIGINIDATRLSNVVEEIRHAVEKVPPEITIKFYR* |
⦗Top⦘ |