Scaffold HQ1_100080

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold HQ1_100080

Scaffold HQ1_100080

Overview

Basic Information
Taxon OID	3300003658 Open in IMG/M
Scaffold ID	HQ1_100080 Open in IMG/M
Source Dataset Name	Hypersaline viral and bacterial communities from Bras del Port, Santa Pola, Spain - HQ1totalprecorrection
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Lifesequencing S.L.
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1104
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hypersaline Samples → Hypersaline Viral And Bacterial Communities From Bras Del Port, Santa Pola, Spain

Source Dataset Sampling Location
Location Name
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065465	Metagenome	127	N

Sequences

Protein ID	Family	RBS	Sequence
HQ1_1000803	F065465	AGGAG	MTEEITVVCECDVLDEARSMGYRRYADMPAADIVAAWPLEYASHGSWDSHILPTLRCLAGYGDRGYGTYQQRQDVALIQNGDEADMPADAIILDSGHLLDDVIDAWHSGRHQAITDTLRQSDEHSLEDIQR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.