Basic Information | |
---|---|
Taxon OID | 3300003658 Open in IMG/M |
Scaffold ID | HQ1_100080 Open in IMG/M |
Source Dataset Name | Hypersaline viral and bacterial communities from Bras del Port, Santa Pola, Spain - HQ1totalprecorrection |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Lifesequencing S.L. |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1104 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hypersaline Samples → Hypersaline Viral And Bacterial Communities From Bras Del Port, Santa Pola, Spain |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | ||||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F065465 | Metagenome | 127 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
HQ1_1000803 | F065465 | AGGAG | MTEEITVVCECDVLDEARSMGYRRYADMPAADIVAAWPLEYASHGSWDSHILPTLRCLAGYGDRGYGTYQQRQDVALIQNGDEADMPADAIILDSGHLLDDVIDAWHSGRHQAITDTLRQSDEHSLEDIQR* |
⦗Top⦘ |