Scaffold SLW02_105284

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold SLW02_105284

Scaffold SLW02_105284

Overview

Basic Information
Taxon OID	3300003653 Open in IMG/M
Scaffold ID	SLW02_105284 Open in IMG/M
Source Dataset Name	Subglacial freshwater microbial communities from Lake Whillans, Antarctica - 0.2 micron filter
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	902
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Subglacial Freshwater → Subglacial Freshwater Microbial Communities From Lake Whillans, Antarctica

Source Dataset Sampling Location
Location Name	West Antarctica
Coordinates	Lat. (^o)	-84.24	Long. (^o)	-153.694	Alt. (m)		Depth (m)	800
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020512	Metagenome / Metatranscriptome	223	Y

Sequences

Protein ID	Family	RBS	Sequence
SLW02_1052841	F020512	N/A	GGQIEGVDFSPQPFQMGRSLLNRVIGLLGSYVDVSTMAQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.