NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SLW02_101057

Scaffold SLW02_101057


Overview

Basic Information
Taxon OID3300003653 Open in IMG/M
Scaffold IDSLW02_101057 Open in IMG/M
Source Dataset NameSubglacial freshwater microbial communities from Lake Whillans, Antarctica - 0.2 micron filter
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3594
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (88.89%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Subglacial Freshwater → Subglacial Freshwater Microbial Communities From Lake Whillans, Antarctica

Source Dataset Sampling Location
Location NameWest Antarctica
CoordinatesLat. (o)-84.24Long. (o)-153.694Alt. (m)Depth (m)800
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000311Metagenome / Metatranscriptome1326Y
F001043Metagenome / Metatranscriptome794Y

Sequences

Protein IDFamilyRBSSequence
SLW02_1010575F001043GAGMFPSMKQLDIQGDKMSDYKEGFDDGVKFAREEMIDKLREIDINDIDSWLLDRLADMIEGGKL*
SLW02_1010576F000311GGAGMYFELQAKTPKSFHHAVWEADLIGLDPKVLSEALLTFNIGTGSIEKVSNLRDKHNLTEIYVSEYETTGYTGR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.