Basic Information | |
---|---|
Taxon OID | 3300003629 Open in IMG/M |
Scaffold ID | P4metv_102754 Open in IMG/M |
Source Dataset Name | Hypersaline viral communities from Bras del Port, Santa Pola, Spain - Lo Valdivia P4 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Lifesequencing S.L. |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1535 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Chromohalobacter → Chromohalobacter salexigens | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Samples → Hypersaline Viral And Bacterial Communities From Bras Del Port, Santa Pola, Spain |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Bras del Port, Santa Pola, Spain | |||||||
Coordinates | Lat. (o) | 38.192206 | Long. (o) | -0.591865 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F038111 | Metagenome | 166 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
P4metv_1027542 | F038111 | N/A | MIYKVPVVNKDNYTIWLENYRNIANFIHADVYNYNKTVRQEFGKDLNVLAKLHNAPLYVLTDKDNKKLKKFMSIYGLVLDHTPLCDDGVEREVYRLDRRV* |
⦗Top⦘ |