Scaffold P4metv_101034

Overview

Basic Information

• Taxon OID: 3300003629
• Scaffold ID: P4metv_101034
• Source Dataset Name: Hypersaline viral communities from Bras del Port, Santa Pola, Spain - Lo Valdivia P4
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Lifesequencing S.L.
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2825
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (87.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Samples → Hypersaline Viral And Bacterial Communities From Bras Del Port, Santa Pola, Spain

Source Dataset Sampling Location

• Location Name: Bras del Port, Santa Pola, Spain
• Coordinates
  • Lat. (^o): 38.192206
  • Long. (^o): -0.591865

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088532	Metagenome	109	Y

Sequences

Protein ID	Family	RBS	Sequence
P4metv_1010347	F088532	AGGA	MIKLELTEQETQALAGLLDAGVKAVGLRAVKDAASLLQKLEDATTPKEEMTDE*