Scaffold P4metv_100259

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold P4metv_100259

Scaffold P4metv_100259

Overview

Basic Information
Taxon OID	3300003629 Open in IMG/M
Scaffold ID	P4metv_100259 Open in IMG/M
Source Dataset Name	Hypersaline viral communities from Bras del Port, Santa Pola, Spain - Lo Valdivia P4
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Lifesequencing S.L.
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6707
Total Scaffold Genes	20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	19 (95.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Samples → Hypersaline Viral And Bacterial Communities From Bras Del Port, Santa Pola, Spain

Source Dataset Sampling Location
Location Name	Bras del Port, Santa Pola, Spain
Coordinates	Lat. (^o)	38.192206	Long. (^o)	-0.591865	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F096726	Metagenome	104	N

Sequences

Protein ID	Family	RBS	Sequence
P4metv_10025920	F096726	AGGTGG	MTRRDDWVRPSRTEASLREHLQRLARGDRLDVDEPTGTLRIERRGPEWRVTHLGTGGGFCWRERMSTRRLLDYLTQWQDRERFDEIELRYVDGDD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.