NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI26273J51734_10002786

Scaffold JGI26273J51734_10002786


Overview

Basic Information
Taxon OID3300003620 Open in IMG/M
Scaffold IDJGI26273J51734_10002786 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8774
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (76.92%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameSaanich Inlet, British Columbia, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005130Metagenome / Metatranscriptome411Y
F007086Metagenome / Metatranscriptome358Y

Sequences

Protein IDFamilyRBSSequence
JGI26273J51734_100027862F005130AGGMSKNKIKLGKVTREVGTTPYKGGHNDIRKTNYEVKITEDGKLDLYTHKTETKEL*
JGI26273J51734_100027864F007086N/AMTKKELYDIINEEIVSFKKGELNEKLNESDKDLIRKIIRQEVSAIFFDLFKRRKTWGA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.