Scaffold JGI26082J51739_10022858

Overview

Basic Information

• Taxon OID: 3300003617
• Scaffold ID: JGI26082J51739_10022858
• Source Dataset Name: Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2555
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: Saanich Inlet, British Columbia, Canada
• Coordinates
  • Lat. (^o): 48.6
  • Long. (^o): -123.5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058189	Metagenome / Metatranscriptome	135	N

Sequences

Protein ID	Family	RBS	Sequence
JGI26082J51739_100228586	F058189	AGG	MKFSCSIDFHLPTQELYDIYWNEFGHKLDDRTLYKDDKRIMPVVTGFLITGKDIKWPVQSLLDALDIELQTARLFVTNPHRKLQIHKDCLGQSKELRPWAINIPIANCDLGINEWFEDHNNDFGTEQFAPGGSAMMPEYFDNNYIVSESMVLNSIQLIKTDVFHRSNNTGNDNRRVVLSLRGKP