NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI26253J51717_1003569

Scaffold JGI26253J51717_1003569


Overview

Basic Information
Taxon OID3300003583 Open in IMG/M
Scaffold IDJGI26253J51717_1003569 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_100m_DNA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5549
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (30.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → unclassified Nitrosomonadales → OM43 clade → Methylophilales bacterium HTCC2181(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameSaanich Inlet, British Columbia, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025861Metagenome / Metatranscriptome200N
F043633Metagenome / Metatranscriptome156N

Sequences

Protein IDFamilyRBSSequence
JGI26253J51717_10035695F025861N/AMLKNIIILVVXIIGGYMVYTNYMQNXEIAALDGVVNEEHPGELNPDDVVSD*
JGI26253J51717_10035698F043633N/AMNFRKAILNFFTLLNTVYLGLVIYIEFFMENLTKDPYEIYYDLWMYVFVGYCAILIFNFAMFGKVTLWNLKSKK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.