Scaffold Ga0007424J51698_1007667

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0007424J51698_1007667

Scaffold Ga0007424J51698_1007667

Overview

Basic Information
Taxon OID	3300003572 Open in IMG/M
Scaffold ID	Ga0007424J51698_1007667 Open in IMG/M
Source Dataset Name	Grassland soil microbial communities from Hopland, California, USA - Sample H3_Bulk_40 (Metagenome Metatranscriptome, Counting Only)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1219
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere → Avena Fatua Rhizosphere Microbial Communities From Hopland, California, Usa

Source Dataset Sampling Location
Location Name	Hopland, California, USA
Coordinates	Lat. (^o)	38.972988	Long. (^o)	-123.116539	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010235	Metagenome / Metatranscriptome	306	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0007424J51698_10076671	F010235	N/A	EGKPITRGDTAMTKFFRSADAAEIYSLEHRFPFAATLIGVFMAGNVGSAVLMLLAQA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.