Scaffold Ga0007419J51692_1006502

Overview

Basic Information

• Taxon OID: 3300003571
• Scaffold ID: Ga0007419J51692_1006502
• Source Dataset Name: Grassland soil microbial communities from Hopland, California, USA - Sample H2_Bulk_35 (Metagenome Metatranscriptome, Counting Only)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 575
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere → Avena Fatua Rhizosphere Microbial Communities From Hopland, California, Usa

Source Dataset Sampling Location

• Location Name: Hopland, California, USA
• Coordinates
  • Lat. (^o): 38.972988
  • Long. (^o): -123.116539

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055462	Metatranscriptome	138	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0007419J51692_10065021	F055462	N/A	APSDLSNQHSGFVSSHPLVSFGLTLTHYNRQLPIYCYWQKFCNRSIPDSAPRLSIPDIPALSFKRTVHSRSITVRDQIQATRSSLQRFKSIKIQLNSFPNLIARLTPITRLDYHSLPFRVGYSIKKRCNEPNHSSFVNLANDRAKLPEVASTTSRDRLFVFSIATVDCPVQRHQITLSNLLKYCYLTASNV