NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0007420J51693_1040271

Scaffold Ga0007420J51693_1040271


Overview

Basic Information
Taxon OID3300003569 Open in IMG/M
Scaffold IDGa0007420J51693_1040271 Open in IMG/M
Source Dataset NameGrassland soil microbial communities from Hopland, California, USA - Sample H2_Bulk_36 (Metagenome Metatranscriptome, Counting Only)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)563
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere → Avena Fatua Rhizosphere Microbial Communities From Hopland, California, Usa

Source Dataset Sampling Location
Location NameHopland, California, USA
CoordinatesLat. (o)38.972988Long. (o)-123.116539Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005632Metagenome / Metatranscriptome394Y
F085785Metagenome / Metatranscriptome111Y

Sequences

Protein IDFamilyRBSSequence
Ga0007420J51693_10402711F005632N/AEVSLWRAVATRFEYDTEKFNVGLGVDLGFGLRVRAAALNMESLSAGVGWHHKL*
Ga0007420J51693_10402712F085785GGAGGMNIDHRNPRLRRGFAFVALAALLGLSVVGLSQCRMVDDTVTGVDLQANSGMNARSDCVHQCNDQYKACKRAEDARHKQAQRDCGSDKACKK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.