Scaffold Ga0007420J51693_1035272

Overview

Basic Information

• Taxon OID: 3300003569
• Scaffold ID: Ga0007420J51693_1035272
• Source Dataset Name: Grassland soil microbial communities from Hopland, California, USA - Sample H2_Bulk_36 (Metagenome Metatranscriptome, Counting Only)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 701
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere → Avena Fatua Rhizosphere Microbial Communities From Hopland, California, Usa

Source Dataset Sampling Location

• Location Name: Hopland, California, USA
• Coordinates
  • Lat. (^o): 38.972988
  • Long. (^o): -123.116539

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092275	Metagenome / Metatranscriptome	107	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0007420J51693_10352721	F092275	N/A	CASNLKMGVHMTRKTLLTTAAFVLTASVAYAGPNVTISKDNKMVSVPAGKAGMSGSWVPGGEAYSNFAKKYPNGLYFCCYGYTLSGPSSFFGAAYATATQWTQAADADVTKLSAAVGYVSGDHTATLTLHSDSGSDTPGAKLGSRTGTTPEFFGGCCGVLTVKLKKPVHLSAGQKYWISITTGGANFNAAPFSTIDQVNPHNGAGSSNGGTTWSGFQSTLVATVSAK*