Scaffold FS898DNA_10484309

Overview

Basic Information

• Taxon OID: 3300003543
• Scaffold ID: FS898DNA_10484309
• Source Dataset Name: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS898_N3Area_DNA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 740
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Source Dataset Sampling Location

• Location Name: Axial seamount, northeast pacific ocean
• Coordinates
  • Lat. (^o): 45.943716
  • Long. (^o): -129.985163
  • Depth (m): 1530

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087903	Metagenome / Metatranscriptome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
FS898DNA_104843092	F087903	N/A	MINTGREWDFMEDEVQIEEILTEANAYNLKQEVITTAKVFMKDDPELNKVVAYEMAYIEWIK*