Scaffold LVWS2TP113H_102044

Overview

Basic Information

• Taxon OID: 3300003528
• Scaffold ID: LVWS2TP113H_102044
• Source Dataset Name: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample LVWS2_TP1_13H
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 614
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Source Dataset Sampling Location

• Location Name: Axial seamount, northeast pacific ocean
• Coordinates
  • Lat. (^o): 45.933251
  • Long. (^o): -130.01379
  • Depth (m): 1542

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019998	Metagenome / Metatranscriptome	226	N

Sequences

Protein ID	Family	RBS	Sequence
LVWS2TP113H_1020441	F019998	N/A	ASVDAIVVGFTTLVWQPLRIIEARRKDLSSDIEVPLMIVGKFDYERIPNKAMASIPLWLYAQTKIAETQVFVWPPTAYANWAIGYSFERRYQDVDSGINSMDFPPEAYESLRYGLGARLGDEFPIDPQRQAMLEQKAAGYFTAMRQASSGNASVKFGVRG*