Basic Information | |
---|---|
Taxon OID | 3300003523 Open in IMG/M |
Scaffold ID | DRAFT_10050247 Open in IMG/M |
Source Dataset Name | Camel rumen microbial communities from Jandagh-Isfahan, Iran - Sample 1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Beijing Genomics Institute (BGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2914 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Camel Rumen → Camel Rumen Microbial Communities From Jandagh-Isfahan, Iran |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Jandaq, Isfahan Province, Iran | |||||||
Coordinates | Lat. (o) | 34.041281 | Long. (o) | 54.414582 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F053097 | Metagenome / Metatranscriptome | 141 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
DRAFT_100502471 | F053097 | N/A | MSIPPFREHFNNAEDKSMALKEMEYVIWLHKWNTPYAAYPADQRPRIVAKDVFKDENYVPSEEVNELARRFNEF* |
⦗Top⦘ |