Scaffold SACTD2sed_1008824

Overview

Basic Information

• Taxon OID: 3300003512
• Scaffold ID: SACTD2sed_1008824
• Source Dataset Name: Macrotidal river microbial communities from the South Alligator River system, Northern Australia - Sample CTD2 sed R1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 698
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Macrotidal River → Macrotidal River Microbial Communities From The South Alligator River System, Northern Australia

Source Dataset Sampling Location

• Location Name: River
• Coordinates
  • Lat. (^o): -12.2376
  • Long. (^o): 132.4096

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048931	Metagenome / Metatranscriptome	147	Y

Sequences

Protein ID	Family	RBS	Sequence
SACTD2sed_10088242	F048931	N/A	MVRQIVDRDTWFIAHNEDLSVIHYGFCAAGTALDSGQPIIEEFDNEADWLIRLAELGIIPEEE*