Scaffold FS857DNA_1002220

Overview

Basic Information

• Taxon OID: 3300003510
• Scaffold ID: FS857DNA_1002220
• Source Dataset Name: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS857_Anemone_DNA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 813
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Source Dataset Sampling Location

• Location Name: Axial seamount, northeast pacific ocean
• Coordinates
  • Lat. (^o): 45.933
  • Long. (^o): -130.01379
  • Depth (m): 1543

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020717	Metagenome / Metatranscriptome	222	Y

Sequences

Protein ID	Family	RBS	Sequence
FS857DNA_10022201	F020717	N/A	MTRKQSEILMTSIVACTRFLALLETTQCWDFLRPHHILHENKDIRYFKDLNEQKDISISALKLMLPEN*