Scaffold JGIcombinedJ51221_10451241

Overview

Basic Information

• Taxon OID: 3300003505
• Scaffold ID: JGIcombinedJ51221_10451241
• Source Dataset Name: Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 520
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies

Source Dataset Sampling Location

• Location Name: Harvard Forest LTER, Petersham, MA, USA
• Coordinates
  • Lat. (^o): 42.53312
  • Long. (^o): -72.189707
  • Depth (m): 0 to .1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024792	Metagenome / Metatranscriptome	204	Y

Sequences

Protein ID	Family	RBS	Sequence
JGIcombinedJ51221_104512411	F024792	AGGA	VTGERLSQAGWLNPSKSESQETETGGRIHQFLWQRSHAVSHAKQELSG*