Scaffold JGI26540J51217_10075258

Overview

Basic Information

• Taxon OID: 3300003489
• Scaffold ID: JGI26540J51217_10075258
• Source Dataset Name: Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_cont_1000_plan
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 923
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa

Source Dataset Sampling Location

• Location Name: South Africa: Cape Town
• Coordinates
  • Lat. (^o): -33.927
  • Long. (^o): 18.452665

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005592	Metagenome / Metatranscriptome	395	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI26540J51217_100752581	F005592	N/A	VQGAGSVKGLVLMETIFPSGDGSTVFDDPKMRQKLMAEIKKGKIKPQTASDEIDVDEDQDSKIDAXVQEIWSYYDPKGLGSIQKKQVTQFFKDCWTXHCLRKHQKEKEALGVGVTMKVALDTAIRMLDPSGAGTVSKQAFIDFLNEVDLVELLGPFTGQTGPRSIPSRLPQNMMFDPSTLPKEAGGKVNLGEVKLRDYNTTLQ*