Basic Information | |
---|---|
Taxon OID | 3300003477 Open in IMG/M |
Scaffold ID | nap3_10084916 Open in IMG/M |
Source Dataset Name | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 3 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 741 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine → Estuary Microbial Community From Gulf Of Naples, Italy |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Gulf of Naples | |||||||
Coordinates | Lat. (o) | 40.7255 | Long. (o) | 14.44767 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F078662 | Metagenome / Metatranscriptome | 116 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
nap3_100849162 | F078662 | N/A | MGDLRPFLRLQSDTWLNTLKQRVADAVLSGAVTTSFTNASQSGSREQVLPTAELSAQLTDVLFEKGLVSGNKPSRMTFARFTR* |
⦗Top⦘ |