NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold KH04C_1169756

Scaffold KH04C_1169756


Overview

Basic Information
Taxon OID3300003446 Open in IMG/M
Scaffold IDKH04C_1169756 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from Douglas Channel, Canada, that are oil-degrading - Sample S18-KH04C
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)586
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From Douglas Channel, Canada, That Are Oil-Degrading

Source Dataset Sampling Location
Location NameDouglas Channel, British Columbia, Canada
CoordinatesLat. (o)53.6667Long. (o)-129.1333Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036024Metagenome / Metatranscriptome171Y

Sequences

Protein IDFamilyRBSSequence
KH04C_11697561F036024N/AMTTEYTMTRIGNKNTFLKLDEATRICQAKIAEYISEVKLEDGEEAIDDYAWHIVTPERFEKDWENDEKLKKTAEIKTKYKNLVKNNRVLFFEVDWN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.