Basic Information | |
---|---|
Taxon OID | 3300003432 Open in IMG/M |
Scaffold ID | JGI20214J51088_10091446 Open in IMG/M |
Source Dataset Name | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2140 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon RBG_16_48_13 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland → Microbial Community Impact On Carbon Sequestration In Managed Wetland Carbon Farming |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sacramento, California, United States | |||||||
Coordinates | Lat. (o) | 38.1072 | Long. (o) | -121.6485 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F020727 | Metagenome / Metatranscriptome | 222 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI20214J51088_100914462 | F020727 | GGA | MMKYQVLIKTVPGKGGEFWEAFQKMATEPMKGVLIESSWSLYGYWDFVLFFKADSNDNSLHFVGEILRAMPGISDTYTSPMNILKEHKM* |
⦗Top⦘ |