Scaffold JGI20214J51088_10009528

Overview

Basic Information

• Taxon OID: 3300003432
• Scaffold ID: JGI20214J51088_10009528
• Source Dataset Name: Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6450
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (87.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland → Microbial Community Impact On Carbon Sequestration In Managed Wetland Carbon Farming

Source Dataset Sampling Location

• Location Name: Sacramento, California, United States
• Coordinates
  • Lat. (^o): 38.1072
  • Long. (^o): -121.6485
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018950	Metagenome / Metatranscriptome	232	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI20214J51088_100095282	F018950	GGA	MTLSRRQVLLASFALLGSSRAALAAASASLLELRVEYTATSVIGAGERAVPGRLWRTHSALRHEGKQQGRPLTVIARLDRNLCWLVLAEPRFAIETDLSALDLPLSVLNGEGGMRELPEGRERVNGLDTTRIRVERDAGSGSSFTGHVWATDQGVVARLAGEGESRGRRGRTLMNFRDVQIGPVDRGLFEAPRGVQLVRVKGGDLATLLEGMAAAGQIGQRR*