Scaffold JGI25912J50252_10027910

Overview

Basic Information

• Taxon OID: 3300003412
• Scaffold ID: JGI25912J50252_10027910
• Source Dataset Name: Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1732
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (87.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location

• Location Name: Lake Michigan, USA
• Coordinates
  • Lat. (^o): 43.1998
  • Long. (^o): -86.5698

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014133	Metagenome	265	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI25912J50252_100279103	F014133	GAG	MNHLKNVWAWFTNHWVMPTPAELIAEELIQAQRTKXRXQSSMEYHTALVAYNVARIKRLRQLXAKTEVVE*