Scaffold JGI26532J50257_10019590

Overview

Basic Information

• Taxon OID: 3300003403
• Scaffold ID: JGI26532J50257_10019590
• Source Dataset Name: Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_cont_500_plan
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2350
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Stylophora → Stylophora pistillata (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa

Source Dataset Sampling Location

• Location Name: South Africa: Cape Town
• Coordinates
  • Lat. (^o): -33.927
  • Long. (^o): 18.452665

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026045	Metagenome	199	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI26532J50257_100195901	F026045	N/A	CNTEWMLDATIEE*DVMAFVSE*LQSVVVEVGDDDSTLIGDAHSLRFVELAWLVAFGAELEQERAIDRRQYLHSMVVGINDNDSMPIIIDRNA*WILVLARLRSSLADREQEREIDRRQEHQSMVVGVGDDDTMMMLVDRNALRKAELEIS*STMADGRQERLLAQ*P*L*