Scaffold JGI26470J50227_1080708

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI26470J50227_1080708

Scaffold JGI26470J50227_1080708

Overview

Basic Information
Taxon OID	3300003375 Open in IMG/M
Scaffold ID	JGI26470J50227_1080708 Open in IMG/M
Source Dataset Name	Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	502
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Lentic Enriched Actinobacterial Communities From Dystrophic Bog Grosse Fuchskuhle, Brandenburg, Germany

Source Dataset Sampling Location
Location Name	Trout Bog Lake, Wisconsin, USA
Coordinates	Lat. (^o)	46.0409	Long. (^o)	-89.686	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082064	Metagenome / Metatranscriptome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI26470J50227_10807081	F082064	AGG	MITYAWSFPQFIVNPSSDGLTNVVTAINWVCTGTNGLVTSSSSGTVQLGTPNPAEFVPYADITQEMAFQWVSQSISITGVEAAIAAQINQISTPQVQPQNPPF*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.