NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI26470J50227_1019221

Scaffold JGI26470J50227_1019221


Overview

Basic Information
Taxon OID3300003375 Open in IMG/M
Scaffold IDJGI26470J50227_1019221 Open in IMG/M
Source Dataset NameFreshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1527
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Lentic Enriched Actinobacterial Communities From Dystrophic Bog Grosse Fuchskuhle, Brandenburg, Germany

Source Dataset Sampling Location
Location NameTrout Bog Lake, Wisconsin, USA
CoordinatesLat. (o)46.0409Long. (o)-89.686Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049367Metagenome146N

Sequences

Protein IDFamilyRBSSequence
JGI26470J50227_10192212F049367GGAGMALQLNLASTQFGAPAPQAYARVTNFFGNKDNIQVQVAVHYSKDAREANMSTVQEHAHYIGLADIAGKGDLLPAIYGVLKTMSQYEGSTDV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.