Scaffold JGI26470J50227_1013823

Overview

Basic Information

• Taxon OID: 3300003375
• Scaffold ID: JGI26470J50227_1013823
• Source Dataset Name: Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1928
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Lentic Enriched Actinobacterial Communities From Dystrophic Bog Grosse Fuchskuhle, Brandenburg, Germany

Source Dataset Sampling Location

• Location Name: Trout Bog Lake, Wisconsin, USA
• Coordinates
  • Lat. (^o): 46.0409
  • Long. (^o): -89.686
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020299	Metagenome	224	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI26470J50227_10138231	F020299	AGGA	MYKEGRQFVVDAKKEFDGVVKDVKGIQNDAKGIWGFLTGLFSGVKQENQQKIVEKPVKKAKQKVEFDENQIYAQVADALTKFFHAYNGLKAYTKEQEELALTADNEEGNDIAIKLVIANLQMEKLNEEMREYMVYHVPPEMKDL